Anti-CHMP2B antibody
| Name | Anti-CHMP2B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133920 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2-51 ( ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK ) of rat CHMP2B (XM_001063932) |
| Description | Rabbit Polyclonal |
| Gene | CHMP2B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CHMP2B antibody (ab133920) at 1 µg/ml + Rat spleen lysate at 10 µg