Anti-CNOT7 antibody
| Name | Anti-CNOT7 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab105525 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the N-terminal amino acids 41-90 ( TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP ) of Human CNOT7 (NP_037486) |
| Description | Rabbit Polyclonal |
| Gene | CNOT7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CNOT7 antibody (ab105525) at 0.25 µg/ml + HepG2 cell lysate at 10 µg