Anti-COMMD1/MURR1 antibody
| Name | Anti-COMMD1/MURR1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab116275 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 110-159 ( MNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFL ) of Human COMMD1/MURR1 (NP_689729) |
| Description | Rabbit Polyclonal |
| Gene | COMMD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-COMMD1/MURR1 antibody (ab116275) at 1 µg/ml + Mouse heart lysate at 10 µg