Anti-CPN1 antibody
| Name | Anti-CPN1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86556 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the internal amino acids 252-301 (QKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT N) of Human CPN1 (NP_001299) |
| Description | Rabbit Polyclonal |
| Gene | CPN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CPN1 antibody (ab86556) at 1 µg/ml (in 5% skim milk / PBS buffer) + transfected 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human heart tissue labelling CPN1 with ab86556 at 2.5µg/ml.