Name | Anti-CYP4F3 antibody |
---|---|
Supplier | Abcam |
Catalog | ab98028 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 35-84 ( LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF ) of Human CYP4F3 (NP_000887) |
Description | Rabbit Polyclonal |
Gene | CYP4F3 |
Conjugate | Unconjugated |
Supplier Page | Shop |