Anti-CYP4F3 antibody
| Name | Anti-CYP4F3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98028 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 35-84 ( LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF ) of Human CYP4F3 (NP_000887) |
| Description | Rabbit Polyclonal |
| Gene | CYP4F3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CYP4F3 antibody (ab98028) at 1 µg/ml + OVCAR-3 cell lysate