Anti-CysLT1 antibody
| Name | Anti-CysLT1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122959 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Horse, Guinea Pig, Bovine, Dog |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 199-248 (IIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFM P) of Human CysLT1 (NP_006630) |
| Description | Rabbit Polyclonal |
| Gene | CYSLTR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CysLT1 antibody (ab122959) at 1 µg/ml + Human fetal heart lysate at 10 µg