Anti-DcR1 antibody
| Name | Anti-DcR1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab1674 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA FC ICC/IF WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide: EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC , corresponding to N terminal amino acids 33-64 of Human DcR1 |
| Description | Goat Polyclonal |
| Gene | TNFRSF10C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
ab1674 recognizes a 66kDa band of expected size in Lane 1 containing TRAIL-3R-Fc protein and showed minimal or no crossreactivity to TRAIL-2R-Fc protein in Lane 2.