Anti-Desmoglein 2 antibody
| Name | Anti-Desmoglein 2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85632 |
| Prices | $379.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P ICC/IF ICC/IF |
| Species Reactivities | Bovine, Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat, Dog, Pig |
| Antigen | A synthetic peptide corresponding to a region within the N terminal amino acids 72-121 ( KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE ) of Human Desmoglein 2, NP_001934 |
| Description | Rabbit Polyclonal |
| Gene | DSG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
