Anti-DMT1 antibody

Name Anti-DMT1 antibody
Supplier Abcam
Catalog ab55735
Prices $384.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a
Applications FC IHC-P WB IHC-F
Species Reactivities Mouse, Human
Antigen Recombinant fragment: MVLGPEQKMSDDSVSGDHGESASLGNINPYSNPSLSQSPGDSEEYFATYF NEKISIPEEEYSCF, corresponding to amino acids 1-66 of Human DMT1 Run BLAST with Run BLAST with
Description Mouse Monoclonal
Gene SLC11A2
Conjugate Unconjugated
Supplier Page Shop

Product images