Name | Anti-DNA Polymerase lambda antibody |
---|---|
Supplier | Abcam |
Catalog | ab82919 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 525 - 574 (SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERD W) of Human DNA Polymerase lambda, (NP_037406) |
Description | Rabbit Polyclonal |
Gene | POLL |
Conjugate | Unconjugated |
Supplier Page | Shop |