Anti-DNA Polymerase lambda antibody
| Name | Anti-DNA Polymerase lambda antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82919 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 525 - 574 (SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERD W) of Human DNA Polymerase lambda, (NP_037406) |
| Description | Rabbit Polyclonal |
| Gene | POLL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DNA Polymerase lambda antibody (ab82919) at 1 µg/ml + fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution