Defb2

Gene Symbol	Defb2
Entrez Gene	13215
Alt Symbol	BD-2
Species	Mouse
Gene Type	protein-coding
Description	defensin beta 2
Other Description	beta-defensin 2
Swissprots	P82020
Accessions	EDL32921 P82020 AJ011800 CAB42815 BC109129 AAI09130 BC109130 AAI09131 NM_010030 NP_034160
Function	Has bactericidal activity. {ECO:0000250}.
Subcellular Location	Secreted {ECO:0000250}.
Tissue Specificity	Kidney, uterus and to a lesser extent in heart. {ECO:0000269|PubMed:9923615}.

• Antibodies
• Assays/Kits
• Proteins/Peptides
• siRNAs/Functional Genomics
• cDNA Clones

Recombinant Mouse Defensin beta 2 Protein - NBP2-35144 from Novus Biologicals Category Protein Prices $69.00, $169.00, $2,669.00 Sizes 5 µg, 20 µg, 1 mg Source E. coli

Mouse Defensin Beta 2 Protein - abx066293 from Abbexa Category Protein Source E.coli Species Mouse

Defensin Beta 2 (DEFb2), Mouse - 20-6198 from ARP American Research Products Category Protein Prices $457.00 Sizes 50 µg Source E.coli Species Mouse

BD 2 Mouse - CYPS-042 from NeoScientific Category Protein Prices $65.00, $169.00, $3,510.00 Sizes 5 µg, 20 µg, 1 mg Source Escherichia Coli. Species Mouse

Recombinant Mouse BD-2 Protein - BP000061-CYT-035 from Syd Labs Category Protein Prices $160.00, $2,700.00 Sizes 20 µg, 1 mg Source E. coli-derived. Species Mouse

Recombinant Mouse Defb2 - Defb2-569M from Creative Biomart Category Protein Source E. coli Species Mouse

GMP Recombinant Murine Defb2 - Defb2-190M from Creative Biomart Category Protein Source E.coli Species Mouse

Mouse beta Defensin-2 Recombinant - RKP82020 from Reprokine Category Protein Prices $70.00, $160.00, $2,700.00 Sizes 5 µg, 20 µg, 1 mg Source Optimized DNA sequence encoding Human beta Defensin-2 mature chain was expressed in Escherichia Coli. Species Mouse

BD-2, Mouse - Z02894-20 from GenScript Category Protein Prices $159.00, $2,100.00 Sizes 20 μg, 1 mg Source E. coli Species Mouse

BD-2, Mouse - Z02894-1 from GenScript Category Protein Prices $159.00, $2,100.00 Sizes 20 μg, 1 mg Source E. coli Species Mouse

Recombinant Defensin Beta 2 (DEFb2) - RPA072Mu01 from Cloud-clone Category Protein Source E.coli Species Mouse

Recombinant Defensin Beta 2 (DEFb2) - RPA072Mu02 from Cloud-clone Category Protein Source E.coli Species Mouse

Recombinant Mouse Beta-defensin 2(Defb2) - CSB-YP006705MO CSB-EP006705MO CSB-BP006705MO CSB-MP006705MO from Cusabio Category Protein Source Yeast or E.coli or Baculovirus or Mammalian cell Species Mouse

Defensin Beta 2 (DEFb2) - RPU141159 from Biomatik Category Protein Prices $213.40, $426.80, $640.20 Sizes 10 µg, 50 µg, 100 µg Source E.coli Species Mouse

Defensin, beta-2 (a.a. 4-41), Human, Peptide - MBS318034 from MyBioSource Category Peptide Prices $855.00 Sizes 100 µg Source Synthetic human beta-Defensin 2 peptide (a.a. 4-41) , (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP) Species Human

Recombinant Mouse Beta Defensin-2 - CS496A from Cell Science Prices $135.00 Sizes 5 μg Species Mouse

Recombinant Mouse Beta Defensin-2 - CS496B from Cell Science Prices $235.00 Sizes 20 μg Species Mouse

Recombinant Mouse Beta Defensin-2 - CS496C from Cell Science Prices $2,700.00 Sizes 1 mg Species Mouse

Recombinant Mouse DEFB2 Protein - DEFB2-4468M from Creative Biomart Category Protein Source Mammalian Cells Species Mouse

Beta Defensin-2 Mouse Recombinant - Pr20190 from ProMab Category Protein Prices $50.00, $130.00, $2,700.00 Sizes 5 μg, 20 μg, 1 mg Source Escherichia Coli. Species Mouse

Recombinant Defensin Beta 2 (DEFb2) - RPU41159 from Biomatik Category Protein Prices $171.00, $349.00, $534.00, $667.36 Sizes 10 µg, 50 µg, 100 µg, 200 µg Source E.coli Species Mouse

DEFB2 Recombinant Protein (OPCD02716) - OPCD02716 from Aviva Systems Biology Category Protein Source E.coli Species Mouse

BD-2, Recombinant Protein - MBS692478 from MyBioSource Category Protein Prices $200.00, $325.00 Sizes 5 µg, 20 µg Source E Coli Species Mouse

beta Defensin-2, Recombinant Protein - MBS553336 from MyBioSource Category Protein Prices $145.00, $220.00 Sizes 5 µg, 20 µg Source E Coli

Beta-defensin 2 (Defb2), Recombinant Protein - MBS1105836 from MyBioSource Category Protein Prices $775.00, $775.00, $1,000.00, $1,000.00, $1,075.00, $1,075.00, $1,535.00, $1,535.00 Sizes 500 µg (E-Coli), 50 µg (Baculovirus), 500 µg (Yeast), 50 µg (Mammalian-Cell), 1 mg (E-Coli), 100 µg (Baculovirus), 1 mg (Yeast), 100 µg (Mammalian-Cell) Source E Coli or Yeast or Baculovirus or Mammalian Cell Species Mouse

Search more