Human Dnmt3L protein fragment
| Name | Human Dnmt3L protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112413 |
| Category | Protein |
| Applications | ELISA WB Array SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | This product is useful for Antibody Production and Protein Array |
| SwissProt/Accession | Q9UJW3 |
| Gene | DNMT3L |
| Residue | 288 to 387 |
| Sequence | LVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSSRHWA LVSEEELSLLAQNKQSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE image, using ab112413. (Stained with Coomassie Blue)