Human DPY30 full length protein
| Name | Human DPY30 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab135020 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >= 85 % by SDS-PAGE. |
| SwissProt/Accession | Q9C005 |
| Gene | DPY30 |
| Residue | 2 to 99 |
| Sequence | EPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSL PTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN |
| Supplier Page | Shop |
Product images
10% SDS-PAGE analysis of ab135020 (19 µg) stained with Coomassie Blue.