Human EED protein fragment
| Name | Human EED protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112381 |
| Category | Protein |
| Applications | WB ELISA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | Useful for Antibody Production and Protein Array |
| SwissProt/Accession | O75530 |
| Gene | EED |
| Residue | 342 to 441 |
| Sequence | KIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDL EVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR |
| Supplier Page | Shop |
Product images
ab112381 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.