GPRC5B fusion protein
| Name | GPRC5B fusion protein |
|---|---|
| Supplier | Proteintech Group |
| Catalog | Ag25225 |
| Category | Protein |
| Prices | $199.00 |
| Sizes | 50 μg |
| Species Reactivities | Human |
| Source | E. coli -derived, PGEX-4T |
| Tag/Conjugation | gst |
| Purity | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Bioactivity | Not tested. |
| Endotoxin | Please contact the lab for more information. |
| Gene | GPRC5B |
| Sequence | HCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYM (293 - 331 aa encoded by BC034467 ) |
| Supplier Page | Shop |
Product images
