Name | Recombinant Homo sapiens (Human) Rho guanine nucleotide exchange factor 18 |
---|---|
Supplier | Cusabio |
Catalog | CSB-EP019681HU |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | E.coli |
Tag/Conjugation | His-SUMO-tag |
Purity | Greater than 90% as determined by SDS-PAGE. |
SwissProt/Accession | P08100? |
Gene | ARHGEF18 |
Residue | 1-36aa |
Sequence | MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQ |
Description | One of full length of Extracellular domain |
Supplier Page | Shop |