Active human Growth hormone receptor protein fragment
| Name | Active human Growth hormone receptor protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab180053 |
| Category | Protein |
| Prices | $357.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 for this effect is typically 0.4 - 2.5 ng/ml. Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells in the presence of 0.2 ng/mL of rhGH. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P10912 |
| Gene | GHR |
| Residue | 27 to 264 |
| Sequence | AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGT KNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYC IKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWE APRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEY EVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab180053 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced protein migrates as 40-50 kDa due to glycosylation.