Active human Growth hormone receptor protein fragment
| Name | Active human Growth hormone receptor protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab180056 |
| Category | Protein |
| Prices | $357.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells in the presence of 0.2 ng/mL of rhGH. The ED50 for this effect is typically 0.8 - 3.5 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P10912 |
| Gene | GHR |
| Residue | 27 to 264 |
| Sequence | AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGT KNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYC IKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWE APRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEY EVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab180056 in reducing (lane 1) and non-reducing (lane 2) conditions. Gel stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 66-85 kDa and non-reduced protein migrates as 135-160 kDa.