TIP120B Recombinant Protein Antigen

Name TIP120B Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-33858PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TIP120B Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CAND2
Sequence MPVLVSGIIFSLADRSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYKIAAEALVVLQELVRALWPLHRPRMLDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGH
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CAND2
Supplier Page Shop