DARPP-32 Recombinant Protein Antigen

Name DARPP-32 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-33534PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody DARPP-32 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PPP1R1B
Sequence PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R1B. Source: E.coli Amino Acid Sequence: PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE
Supplier Page Shop