integrin beta 4 binding protein Recombinant Protein Antigen

Name integrin beta 4 binding protein Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-13954PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody integrin beta 4 binding protein Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene EIF6
Sequence LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF6
Supplier Page Shop