TTC37 Recombinant Protein Antigen

Name TTC37 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-93640PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TTC37 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TTC37
Sequence QLGLTYWFMGEETRKDKTKALTHFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVELEDMEMALAILTTVTQK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TTC37
Supplier Page Shop