Proteasome 20S alpha 3 Recombinant Protein Antigen

Name Proteasome 20S alpha 3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-92293PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Proteasome 20S alpha 3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PSMA3
Sequence FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMA3
Supplier Page Shop