Band 3 Recombinant Protein Antigen

Name Band 3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-90226PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Band 3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC4A1
Sequence LLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC4A1
Supplier Page Shop