CDCA2 Recombinant Protein Antigen

Name CDCA2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-87140PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CDCA2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CDCA2
Sequence IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDCA2
Supplier Page Shop