G-substrate Recombinant Protein Antigen

Name G-substrate Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-13800PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody G-substrate Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PPP1R17
Sequence DRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALH
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R17
Supplier Page Shop