IP3R3 Recombinant Protein Antigen

Name IP3R3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83101PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody IP3R3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ITPR3
Sequence ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIMQPILRFLQLLCENHNRD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITPR3
Supplier Page Shop