RNF44 Recombinant Protein Antigen

Name RNF44 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82930PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody RNF44 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene RNF44
Sequence MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPSRPPHLPVEERRASAPAGGSPRMLHPATQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF44
Supplier Page Shop