RBM5 Recombinant Protein Antigen

Name RBM5 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83305PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody RBM5 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene RBM5
Sequence WSSTQSQSGEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYY
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBM5
Supplier Page Shop