Elf4/MEF Recombinant Protein Antigen

Name Elf4/MEF Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-33286PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Elf4/MEF Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ELF4
Sequence SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELF4
Supplier Page Shop