MMS19 like protein Recombinant Protein Antigen

Name MMS19 like protein Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-47371PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MMS19 like protein Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MMS19
Sequence IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMS19
Supplier Page Shop