NG2/MCSP Recombinant Protein Antigen

Name NG2/MCSP Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-89682PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody NG2/MCSP Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CSPG4
Sequence ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CSPG4
Supplier Page Shop