DNA Ligase IV Recombinant Protein Antigen

Name DNA Ligase IV Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-87405PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody DNA Ligase IV Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene LIG4
Sequence TYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIG4
Supplier Page Shop