NLRP10/Pynod/NALP10 Recombinant Protein Antigen

Name NLRP10/Pynod/NALP10 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-85557PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody NLRP10/Pynod/NALP10 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene NLRP10
Sequence RLLEVKEQEGNDEMTLTMQFLLDISKKDSFSNLELKFCFRISPCLAQDLKHFKEQMESMKHNRTWDLEFSLYEAKIKNLVKGIQMNNVSFKIKHSNEKKSQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP10
Supplier Page Shop