17 beta-HSD14/HSD17B14 Recombinant Protein Antigen

Name 17 beta-HSD14/HSD17B14 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-85220PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody 17 beta-HSD14/HSD17B14 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene HSD17B14
Sequence ATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIR
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSD17B14
Supplier Page Shop