17 beta-HSD14/HSD17B14 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-85220
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:ATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIR
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: 17 beta-HSD14/HSD17B14 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: HSD17B14

Product images

Western Blot: HSD17B14 Antibody [NBP1-85220] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414089)

Immunocytochemistry/Immunofluorescence: HSD17B14 Antibody [NBP1-85220] - Staining of human cell line U-251MG shows positivity in cytoplasm & centrosome.

Immunohistochemistry-Paraffin: HSD17B14 Antibody [NBP1-85220] - Staining of human stomach shows strong cytoplasmic positivity in Chief cells.