FBXW8 Recombinant Protein Antigen

Name FBXW8 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84715PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody FBXW8 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene FBXW8
Sequence KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXW8
Supplier Page Shop