YOD1 Recombinant Protein Antigen

Name YOD1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84173PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody YOD1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene YOD1
Sequence DMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YOD1
Supplier Page Shop