Human Estrogen Inducible Protein pS2 full length protein
| Name | Human Estrogen Inducible Protein pS2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab109944 |
| Category | Protein |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 90 % by SDS-PAGE. ab109944 was purified using conventional chromatography techniques. |
| SwissProt/Accession | P04155 |
| Gene | TFF1 |
| Residue | 25 to 84 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMEAQTETCTVAPRERQNCGFPGVTPSQCAN KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of 3µg ab109944.