TRPM7 Recombinant Protein Antigen

Name TRPM7 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84493PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody TRPM7 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TRPM7
Sequence IFGQDLPAVPQRKEFNFPEAGSSSGALFPSAVSPPELRQRLHGVELLKIFNKNQKLGSSSTSIPHLSSPPTK
Description A recombinant protein antigen corresponding to TRPM7
Supplier Page Shop