NT5C Recombinant Protein Antigen

Name NT5C Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84563PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody NT5C Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene NT5C
Sequence VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NT5C. Source: E.coli Amino Acid Sequence: VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP
Supplier Page Shop