CLE7 homolog Recombinant Protein Antigen

Name CLE7 homolog Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84498PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CLE7 homolog Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C14orf166
Sequence ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C14ORF166
Supplier Page Shop