TRIM72 Recombinant Protein Antigen

Name TRIM72 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-49157PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TRIM72 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TRIM72
Sequence LEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM72
Supplier Page Shop