R-Spondin 4 Recombinant Protein Antigen

Name R-Spondin 4 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30540PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody R-Spondin 4 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene RSPO4
Sequence KCLHDCPPGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRQFYLYKGKCLPTCPPGTLAHQNTRECQGECELGPWG
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RSPO4
Supplier Page Shop