RUNX1T1/ETO Recombinant Protein Antigen

• Supplier: Novus Biologicals
• Catalog: NBP2-49644PEP
• Category: Protein
• Prices: $199.00
• Sizes: 100 µl
• For Antibody: RUNX1T1/ETO Antibody
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Gene: RUNX1T1
• Sequence: RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT
• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RUNX1T1/ETO. Source: E. coli Amino Acid Sequence: RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT