Integrin alpha 3/CD49c Recombinant Protein Antigen

• Supplier: Novus Biologicals
• Catalog: NBP2-48514PEP
• Category: Protein
• Prices: $199.00
• Sizes: 100 µl
• For Antibody: Integrin alpha 3/CD49c Antibody
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Gene: ITGA3
• Sequence: AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV
• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Integrin alpha 3/CD49c