SH3BP4 Recombinant Protein Antigen

Name SH3BP4 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86274PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SH3BP4 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SH3BP4
Sequence EGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNT
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH3BP4
Supplier Page Shop