ENPP6 Recombinant Protein Antigen

Name ENPP6 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82710PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody ENPP6 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ENPP6
Sequence RKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS
Description A recombinant protein antigen corresponding to ENPP6
Supplier Page Shop