CD96 Recombinant Protein Antigen

Name CD96 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-49491PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CD96 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CD96
Sequence VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD96
Supplier Page Shop