UNC13B Recombinant Protein Antigen

Name UNC13B Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-49364PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody UNC13B Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene UNC13B
Sequence PPDLVLQKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIPDD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UNC13B. Source: E. coli Amino Acid Sequence: PPDLVLQKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIPDD
Supplier Page Shop